missing translation for 'onlineSavingsMsg'
Learn More

sodium channel, voltage-gated, type IX, alpha subunit, Mouse, Clone: 5A11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SCN9A.

Supplier: Abnova Corporation H00006335M01

Catalog No. 89-014-186

$406.20 / Each

Quantity

Description

This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. [provided by RefSeq

Sequence: GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY

Specifications

Antigen	sodium channel, voltage-gated, type IX, alpha subunit
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_002977
Gene Symbols	SCN9A
Immunogen	SCN9A (NP_002968, 269 a.a. ∼ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	ELISA, Western Blot
Clone	5A11
Description	Mouse monoclonal antibody raised against a partial recombinant SCN9A.
Gene	SCN9A
Gene Alias	ETHA/NE-NA/NENA/Nav1.7/PN1
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	6335
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2b κ

Product Suggestions

sodium channel, voltage-gated, type IX, alpha subunit, Mouse, Clone: 5A11, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions