missing translation for 'onlineSavingsMsg'
Learn More

PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PRPF19.

Supplier: Abnova Corporation H00027339A01

Catalog No. 89-004-600

Quantity

Description

PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]).[supplied by OMIM

Sequence: MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF

Specifications

Antigen	PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant PRPF19.
Gene	PRPF19
Gene Alias	NMP200/PRP19/PSO4/SNEV/UBOX4/hPSO4
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	27339
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_014502
Gene Symbols	PRPF19
Immunogen	PRPF19 (NP_055317, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

Description