missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89018837

protein kinase, cGMP-dependent, type II, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89018837
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89018837 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89018837 Supplier Abnova Corporation Supplier No. H00005593A01
Only null left

Description

Mouse polyclonal antibody raised against a partial recombinant PRKG2.

Sequence: MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDK

Specifications

Antigen protein kinase, cGMP-dependent, type II
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant PRKG2.
Formulation 50% glycerol
Gene PRKG2
Gene Accession No. NM_006259
Gene Alias PRKGR2/cGKII
Gene Symbols PRKG2
Host Species Mouse
Immunogen PRKG2 (NP_006250, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Cell Cycle
Primary or Secondary Primary
Gene ID (Entrez) 5593
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less