missing translation for 'onlineSavingsMsg'
Learn More

protein kinase, cGMP-dependent, type II, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant PRKG2.

Supplier: Abnova Corporation H00005593A01

Catalog No. 89-018-837

Quantity

Description

Sequence: MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDK

Specifications

Antigen	protein kinase, cGMP-dependent, type II
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant PRKG2.
Gene	PRKG2
Gene Alias	PRKGR2/cGKII
Host Species	Mouse
Quantity	50 μL
Research Discipline	Cell Cycle
Gene ID (Entrez)	5593
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_006259
Gene Symbols	PRKG2
Immunogen	PRKG2 (NP_006250, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

Description