missing translation for 'onlineSavingsMsg'
Learn More

phosphoinositide-3-kinase, regulatory subunit 4, Mouse, Clone: 1B5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PIK3R4.

Supplier: Abnova Corporation H00030849M02

Catalog No. 89-001-271

Quantity

Description

Sequence: AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK

Specifications

Antigen	phosphoinositide-3-kinase, regulatory subunit 4
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_014602
Gene Symbols	PIK3R4
Immunogen	PIK3R4 (NP_055417, 1259 a.a. ∼ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Research Discipline	Kinases
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Clone	1B5
Description	Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Gene	PIK3R4
Gene Alias	MGC102700/VPS15/p150
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	30849
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2a κ

Product Suggestions

Description