missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89008505

N-terminal asparagine amidase, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89008505
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89008505 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89008505 Supplier Abnova Corporation Supplier No. H00123803B01
Only null left

Description

Mouse polyclonal antibody raised against a full-length human NTAN1 protein.

Sequence: MPLLVEGRRVRLPQSAGDLVRAHPPLEERARLLRGQSVQQVGPQGLLYVQQRELAVTSPKDGSISILGSDDATTCHIVVLRHTGNGATCLTHCDGTDTKAEVPLIMNSIKSFSDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVTELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGPEEQLRAARTLAGGPMISIYDAETEQLRIGPYSWTPFPHVDFWLHQDDKQILENLSTSPLAEPPHFVEHIRSTLMFLKKHPSPAHTLFSGNKALLYKKNEDGLWEKISSPGS

Specifications

Antigen N-terminal asparagine amidase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human NTAN1 protein.
Formulation No additive
Gene NTAN1
Gene Accession No. NM_173474.2
Gene Alias DKFZp666E058
Gene Symbols NTAN1
Host Species Mouse
Immunogen NTAN1 (NP_775745.1, 1 a.a. ∼ 310 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Endocrine/Metabolism
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 123803
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less