missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004688

nicalin homolog (zebrafish), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004688
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89004688 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89004688 Supplier Abnova Corporation Supplier No. H00056926A01
Only null left

Description

Mouse polyclonal antibody raised against a partial recombinant NCLN.

Sequence: HEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVLMRLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVY

Specifications

Antigen nicalin homolog (zebrafish)
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant NCLN.
Formulation 50% glycerol
Gene NCLN
Gene Accession No. NM_020170
Gene Symbols NCLN
Host Species Mouse
Immunogen NCLN (NP_064555, 44 a.a. ∼ 144 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 56926
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less