missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123233

MSX1, Mouse, Clone: 1E2, Abnova™

Catalog No. 89123233
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89123233 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89123233 Supplier Abnova Corporation Supplier No. H00004487M11
Only null left

Description

Mouse monoclonal antibody raised against a partial recombinant MSX1.

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq

Sequence: NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Specifications

Antigen MSX1
Applications ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1E2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant MSX1.
Formulation PBS with no preservative; pH 7.4
Gene MSX1
Gene Accession No. NM_002448
Gene Alias HOX7/HYD1
Gene Symbols MSX1
Host Species Mouse
Immunogen MSX1 (NP_002439, 216 a.a. ∼ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4487
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less