missing translation for 'onlineSavingsMsg'
Learn More

lymphocyte antigen 75, Mouse, Clone: 3G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant LY75.

Supplier: Abnova Corporation H00004065M10

Catalog No. 89-000-782

Quantity

Description

Sequence: TIVHGNTGKCIKPVYGWIVADDCDETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAARYRLALKDGHGTAIS*

Specifications

Antigen	lymphocyte antigen 75
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_002349
Gene Symbols	LY75
Immunogen	LY75 (NP_002340, 37 a.a. ∼ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Whole Molecule	Yes
Gene ID (Entrez)	4065
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2b κ

Applications	ELISA
Clone	3G4
Description	Mouse monoclonal antibody raised against a partial recombinant LY75.
Gene	LY75
Gene Alias	CD205/CLEC13B/DEC-205/GP200-MR6
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Product Suggestions

Description