missing translation for 'onlineSavingsMsg'
Learn More

LRRK1, Mouse, Clone: 3G8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant LRRK1.

Supplier: Abnova Corporation H00079705M03

Catalog No. 89-002-656

Quantity

Description

Sequence: PGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIWVPRRGGDVIVIGLEKDSEAQRGRVIAVLKARELTPHGIMPVSSVKVCWAGWPVRDMVYMAAVM

Specifications

Antigen	LRRK1
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	BC005408
Gene Symbols	LRRK1
Immunogen	LRRK1 (AAH05408, 560 a.a. ∼ 659 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG1 κ

Applications	ELISA, Immunofluorescence, Immunoprecipitation
Clone	3G8
Description	Mouse monoclonal antibody raised against a partial recombinant LRRK1.
Gene	LRRK1
Gene Alias	FLJ23119/FLJ27465/KIAA1790/RIPK6/Roco1
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	79705
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

Product Suggestions

Description