missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89003019

LMX1B, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89003019
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89003019 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89003019 Supplier Abnova Corporation Supplier No. H00004010A01
Only null left

Description

Mouse polyclonal antibody raised against a partial recombinant LMX1B.

Sequence: MLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALE

Specifications

Antigen LMX1B
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant LMX1B.
Formulation 50% glycerol
Gene LMX1B
Gene Accession No. NM_002316
Gene Alias LMX1.2/MGC138325/MGC142051/NPS1
Gene Symbols LMX1B
Host Species Mouse
Immunogen LMX1B (NP_002307, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4010
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less