missing translation for 'onlineSavingsMsg'
Learn More

Kruppel-like factor 11, Mouse, Clone: 10D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant KLF11.

Supplier: Abnova Corporation H00008462M03

Catalog No. 89-001-082

Quantity

Description

Sequence: TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA

Specifications

Antigen	Kruppel-like factor 11
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_003597
Gene Symbols	KLF11
Immunogen	KLF11 (NP_003588, 404 a.a. ∼ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Research Discipline	Cell Cycle
Primary or Secondary	Primary
Target Species	Human, Mouse, Rat
Product Type	Antibody

Applications	ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Clone	10D8
Description	Mouse monoclonal antibody raised against a partial recombinant KLF11.
Gene	KLF11
Gene Alias	FKLF/FKLF1/MODY7/TIEG2/Tieg3
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	8462
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2a κ

Product Suggestions

Description