missing translation for 'onlineSavingsMsg'
Learn More

interferon regulatory factor 4, Mouse, Clone: 3A10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant IRF4.

Supplier: Abnova Corporation H00003662M04

Catalog No. 89-000-761

Quantity

Description

Sequence: LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Specifications

Antigen	interferon regulatory factor 4
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_002460
Gene Symbols	IRF4
Immunogen	IRF4 (NP_002451, 342 a.a. ∼ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Research Discipline	Transcription Regulation
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Applications	ELISA, Western Blot
Clone	3A10
Description	Mouse monoclonal antibody raised against a partial recombinant IRF4.
Gene	IRF4
Gene Alias	LSIRF/MUM1
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	3662
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2a κ

Product Suggestions

Description