missing translation for 'onlineSavingsMsg'
Learn More
Learn More
gap junction protein, alpha 1, 43kDa, Mouse, Clone: 3E5, Abnova™
Mouse monoclonal antibody raised against a partial recombinant GJA1.
Supplier: Abnova Corporation H00002697M01
Description
This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. [provided by RefSeq
Sequence: GSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD*Specifications
| gap junction protein, alpha 1, 43kDa | |
| Monoclonal | |
| Unconjugated | |
| PBS with no preservative; pH 7.4 | |
| BC026329 | |
| GJA1 | |
| GJA1 (AAH26329, 261 a.a. ∼ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody |
| ELISA, Western Blot | |
| 3E5 | |
| Mouse monoclonal antibody raised against a partial recombinant GJA1. | |
| GJA1 | |
| CX43/DFNB38/GJAL/ODDD | |
| Mouse | |
| Affinity Purified | |
| RUO | |
| 2697 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| IgG1 κ |