missing translation for 'onlineSavingsMsg'
Learn More

gastrulation brain homeobox 2, Mouse, Clone: 2D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant GBX2.

Supplier: Abnova Corporation H00002637M02

Catalog No. 89-000-678

Quantity

Description

Sequence: ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG

Specifications

Antigen	gastrulation brain homeobox 2
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_001485
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	2637
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2a κ

Applications	ELISA, Immunofluorescence, Western Blot
Clone	2D8
Description	Mouse monoclonal antibody raised against a partial recombinant GBX2.
Gene	GBX2
Gene Symbols	GBX2
Immunogen	GBX2 (NP_001476, 114 a.a. ∼ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Research Discipline	Neurobiology
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

Product Suggestions

Description