missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FRZB, Mouse, Clone: 3C3, Abnova™
Mouse monoclonal antibody raised against a full-length recombinant FRZB.
Supplier: Abnova Corporation H00002487M07
Description
Sequence: HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*Specifications
| FRZB | |
| Monoclonal | |
| Unconjugated | |
| PBS with no preservative; pH 7.4 | |
| NM_001463 | |
| FRZB | |
| FRZB (NP_001454, 102 a.a. ∼ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG2a κ |
| ELISA, Western Blot | |
| 3C3 | |
| Mouse monoclonal antibody raised against a full length recombinant FRZB. | |
| FRZB | |
| FRE/FRITZ/FRP-3/FRZB-1/FRZB-PEN/FRZB1/FZRB/SFRP3/SRFP3/hFIZ | |
| Mouse | |
| Affinity chromatography | |
| RUO | |
| 2487 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| Liquid |