missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001250

forkhead box P1, Mouse, Clone: 4E3-G11, Abnova™

Catalog No. 89001250
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89001250 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89001250 Supplier Abnova Corporation Supplier No. H00027086M01
Only null left

Description

Mouse monoclonal antibody raised against a full-length recombinant FOXP1.

This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF

Specifications

Antigen forkhead box P1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4E3-G11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant FOXP1.
Formulation PBS with no preservative; pH 7.4
Gene FOXP1
Gene Accession No. BC005055
Gene Alias 12CC4/FLJ23741/HSPC215/MGC12942/MGC88572/MGC99551/QRF1/hFKH1B
Gene Symbols FOXP1
Host Species Mouse
Immunogen FOXP1 (AAH05055, 1 a.a. ∼ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 27086
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b
Show More Show Less