missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022194

FLT4, Mouse, Clone: 5B5, Abnova™

Catalog No. 89022194
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89022194 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89022194 Supplier Abnova Corporation Supplier No. H00002324M04
Only null left

Description

Mouse monoclonal antibody raised against a partial recombinant FLT4.

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq

Sequence: ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR

Specifications

Antigen FLT4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5B5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant FLT4.
Formulation PBS with no preservative; pH 7.4
Gene FLT4
Gene Accession No. NM_002020
Gene Alias FLT41/LMPH1A/PCL/VEGFR3
Gene Symbols FLT4
Host Species Mouse
Immunogen FLT4 (NP_002011, 34 a.a. ∼ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2324
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less