missing translation for 'onlineSavingsMsg'
Learn More
Learn More
filamin C, gamma (actin binding protein 280), Mouse, Polyclonal Antibody, Abnova™
Description
This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Sequence: SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP
Specifications
Specifications
| Antigen | filamin C, gamma (actin binding protein 280) |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Description | Mouse polyclonal antibody raised against a partial recombinant FLNC. |
| Formulation | 50% glycerol |
| Gene | FLNC |
| Gene Accession No. | NM_001458 |
| Gene Alias | ABP-280/ABP280A/ABPA/ABPL/FLJ10186/FLN2 |
| Gene Symbols | FLNC |
| Show More |