Learn More
FABP1, Mouse, Clone: 6E8, Abnova™
Mouse monoclonal antibody raised against a full-length recombinant FABP1.
Supplier: Abnova Corporation H00002168M03
Description
FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq
Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI- Environmental benefits include:
- Free-of a substance that causes environmental harm
Specifications
FABP1 | |
Monoclonal | |
Unconjugated | |
PBS with no preservative; pH 7.4 | |
BC032801 | |
FABP1 | |
FABP1 (AAH32801, 1 a.a. ∼ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
100 μg | |
Primary | |
Human | |
Antibody | |
IgG2b κ |
ELISA, Western Blot | |
6E8 | |
Mouse monoclonal antibody raised against a full-length recombinant FABP1. | |
FABP1 | |
FABPL/L-FABP | |
Mouse | |
Affinity chromatography | |
RUO | |
2168 | |
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
Liquid |