missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022021

F2R, Mouse, Clone: 2C5, Abnova™

Catalog No. 89022021
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89022021 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89022021 Supplier Abnova Corporation Supplier No. H00002149M01

Description

Mouse monoclonal antibody raised against a partial recombinant F2R.

Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. [provided by RefSeq

Sequence: SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT

Specifications

Antigen F2R
Applications ELISA, In situ PLA, Western Blot
Classification Monoclonal
Clone 2C5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant F2R.
Formulation PBS with no preservative; pH 7.4
Gene F2R
Gene Accession No. NM_001992
Gene Alias CF2R/HTR/PAR1/TR
Gene Symbols F2R
Host Species Mouse
Immunogen F2R (NP_001983.1, 42 a.a. ∼ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2149
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less