missing translation for 'onlineSavingsMsg'
Learn More

EVL, Mouse, Clone: 1D6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EVL.

Supplier: Abnova Corporation H00051466M02

Catalog No. 89-002-632

Quantity

Description

Sequence: PGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT

Specifications

Antigen	EVL
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_016337
Gene Symbols	EVL
Immunogen	EVL (NP_057421, 309 a.a. ∼ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG2a κ

Applications	ELISA, Western Blot
Clone	1D6
Description	Mouse monoclonal antibody raised against a partial recombinant EVL.
Gene	EVL
Gene Alias	RNB6
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	51466
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

Product Suggestions

Description