missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000641

enhancer of rudimentary homolog (Drosophila), Mouse, Clone: 4A10, Abnova™

Catalog No. 89000641
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89000641 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89000641 Supplier Abnova Corporation Supplier No. H00002079M14
Only null left

Description

Mouse monoclonal antibody raised against a full-length recombinant ERH.

Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

Specifications

Antigen enhancer of rudimentary homolog (Drosophila)
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 4A10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant ERH.
Formulation PBS with no preservative; pH 7.4
Gene ERH
Gene Accession No. BC014301
Gene Alias DROER/FLJ27340
Gene Symbols ERH
Host Species Mouse
Immunogen ERH (AAH14301, 1 a.a. ∼ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 2079
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less