missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DLX5, Mouse, Clone: 1B7, Abnova™
Mouse monoclonal antibody raised against a partial recombinant DLX5.
Supplier: Abnova Corporation H00001749M02
Description
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. [provided by RefSeq
Sequence: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*Specifications
| DLX5 | |
| Monoclonal | |
| Unconjugated | |
| PBS with no preservative; pH 7.4 | |
| NM_005221 | |
| Mouse | |
| Affinity chromatography | |
| RUO | |
| 1749 | |
| Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | |
| Liquid |
| ELISA, Immunohistochemistry (PFA fixed) | |
| 1B7 | |
| Mouse monoclonal antibody raised against a partial recombinant DLX5. | |
| DLX5 | |
| DLX5 | |
| DLX5 (NP_005212, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG2b κ |