missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000592

CSE1 chromosome segregation 1-like (yeast), Mouse, Clone: 2C10, Abnova™

Catalog No. 89000592
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89000592 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89000592 Supplier Abnova Corporation Supplier No. H00001434M03
Only null left

Description

Mouse monoclonal antibody raised against a partial recombinant CSE1L.

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. [provided by RefSeq

Sequence: LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL

Specifications

Antigen CSE1 chromosome segregation 1-like (yeast)
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 2C10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CSE1L.
Formulation PBS with no preservative; pH 7.4
Gene CSE1L
Gene Accession No. NM_001316
Gene Alias CAS/CSE1/MGC117283/MGC130036/MGC130037/XPO2
Gene Symbols CSE1L
Host Species Mouse
Immunogen CSE1L (NP_001307, 872 a.a. ∼ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 1434
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less