missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89015803

CDC14 cell division cycle 14 homolog B (S. cerevisiae), Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89015803
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89015803 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89015803 Supplier Abnova Corporation Supplier No. H00008555B01P
Only null left

Description

Mouse polyclonal antibody raised against a full-length human CDC14B protein.

The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq

Sequence: MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTDGWLSQAVTFLDRLLIWLGIHKD

Specifications

Antigen CDC14 cell division cycle 14 homolog B (S. cerevisiae)
Applications Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human CDC14B protein.
Formulation PBS with no preservative; pH 7.4
Gene CDC14B
Gene Accession No. ENST00000265659
Gene Alias CDC14B3/Cdc14B1/Cdc14B2/hCDC14B
Gene Symbols CDC14B
Host Species Mouse
Immunogen CDC14B (ENSP00000265659, 1 a.a. ∼ 471 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8555
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less