missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

CD274 molecule, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CD274.

Supplier:  Abnova Corporation H00029126A01

Catalog No. 89-004-602



Description

Description

Sequence: ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
Specifications

Specifications

CD274 molecule
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant CD274.
CD274
B7-H/B7H1/MGC142294/MGC142296/PD-L1/PDCD1L1/PDCD1LG1/PDL1
Mouse
50 μL
Signal Transduction
Primary
Human
Serum
ELISA, Western Blot
Unconjugated
50% glycerol
NM_014143
CD274
CD274 (NP_054862, 141 a.a. ∼ 240 a.a) partial recombinant protein with GST tag.
RUO
Yes
29126
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
SDS
Documents

Documents

Promotions

Promotions