missing translation for 'onlineSavingsMsg'
Learn More

CD274 molecule, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CD274.

Supplier: Abnova Corporation H00029126A01

Catalog No. 89-004-602

Quantity

Description

Sequence: ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH

Specifications

Antigen	CD274 molecule
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant CD274.
Gene	CD274
Gene Alias	B7-H/B7H1/MGC142294/MGC142296/PD-L1/PDCD1L1/PDCD1LG1/PDL1
Host Species	Mouse
Quantity	50 μL
Research Discipline	Signal Transduction
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_014143
Gene Symbols	CD274
Immunogen	CD274 (NP_054862, 141 a.a. ∼ 240 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Whole Molecule	Yes
Gene ID (Entrez)	29126
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Product Suggestions

Description