missing translation for 'onlineSavingsMsg'
Learn More

breast carcinoma amplified sequence 2 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BCAS2.

Supplier: Abnova Corporation H00010286A01

Catalog No. 89004484

Quantity

Description

Sequence: HQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF

Specifications

Antigen	breast carcinoma amplified sequence 2
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant BCAS2.
Gene	BCAS2
Gene Alias	DAM1
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	10286
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_005872
Gene Symbols	BCAS2
Immunogen	BCAS2 (NP_005863, 116 a.a. ∼ 225 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

Description