Learn More
Rho guanine nucleotide exchange factor (GEF) 7, Mouse, Polyclonal Antibody, Abnova™
Mouse polyclonal antibody raised against a partial recombinant ARHGEF7.
Supplier: Abnova Corporation H00008874A01
Description
Rho GTPases play a fundamental role in numerous cellular processes triggered by extracellular stimuli that work through G protein coupled receptors. The encoded protein belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. This protein can induce membrane ruffling. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Sequence: SSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVI- Environmental benefits include:
- Renewable Energy
Specifications
Rho guanine nucleotide exchange factor (GEF) 7 | |
Polyclonal | |
Mouse polyclonal antibody raised against a partial recombinant ARHGEF7. | |
ARHGEF7 | |
BETA-PIX/COOL1/DKFZp686C12170/DKFZp761K1021/KIAA0142/KIAA0412/Nbla10314/P50/P50BP/P85/P85COOL1/P85SPR/PAK3/PIXB | |
Mouse | |
50 μL | |
Signal Transduction | |
Primary | |
Human | |
Serum |
ELISA, Western Blot | |
Unconjugated | |
50% glycerol | |
NM_145735 | |
ARHGEF7 | |
ARHGEF7 (NP_663788, 102 a.a. ∼ 190 a.a) partial recombinant protein with GST tag. | |
RUO | |
Yes | |
8874 | |
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |