missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89003134

ARHGEF12, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89003134
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89003134 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89003134 Supplier Abnova Corporation Supplier No. H00023365A01
Only null left

Description

Mouse polyclonal antibody raised against a partial recombinant ARHGEF12.

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. This protein is observed to form myeloid/lymphoid fusion partner in acute myeloid leukemia. [provided by RefSeq

Sequence: VSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAE

Specifications

Antigen ARHGEF12
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant ARHGEF12.
Formulation 50% glycerol
Gene ARHGEF12
Gene Accession No. NM_015313
Gene Alias DKFZp686O2372/KIAA0382/LARG/PRO2792
Gene Symbols ARHGEF12
Host Species Mouse
Immunogen ARHGEF12 (NP_056128, 817 a.a. ∼ 916 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23365
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Liquid
Show More Show Less