missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP187381PE

Novus Biologicals™ Splicing factor, arginine/serine-rich 11 Recombinant Protein Antigen

Catalog No. NBP187381PE
Change view
Click to view available options
Quantity:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP187381PE 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP187381PE Supplier Novus Biologicals™ Supplier No. NBP187381PEP
Only null left

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRSF11. The Splicing factor, arginine/serine-rich 11 Recombinant Protein Antigen is derived from E. coli. The Splicing factor, arginine/serine-rich 11 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87381. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Gene ID (Entrez) 9295
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol SRSF11
Label Type Unlabeled
Molecular Weight (g/mol) 30kDa
Product Type Splicing factor, arginine/serine-rich 11
Quantity 0.1mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87381. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSR
Show More Show Less

For Research Use Only