missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP256041PE

Novus Biologicals™ PRMT5 Recombinant Protein Antigen

Catalog No. NBP256041PE
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP256041PE 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP256041PE Supplier Novus Biologicals™ Supplier No. NBP256041PEP
Only null left

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRMT5. Source: E.coli Amino Acid Sequence: GRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENA The PRMT5 Recombinant Protein Antigen is derived from E. coli. The PRMT5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

Gene ID (Entrez) 10419
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name PRMT5 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT5, HMT1 hnRNP methyltransferase-like 5,72 kDa ICln-binding protein, HRMT1L5, IBP72, Jak-binding protein 1, JBP1, protein arginine methyltransferase 5, protein arginine N-methyltransferase
Gene Symbol PRMT5
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52802. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.