missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109798

Invitrogen™ Human ZMIZ2 (aa 270-339) Control Fragment Recombinant Protein

Catalog No. RP109798
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109798 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109798 Supplier Invitrogen™ Supplier No. RP109798
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145018 (PA5-145018. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZIMP7, also known as ZMIZ2, is a novel PIAS (protein inhibitor of activated signal transducer and activator of transcription)-like protein and a transcriptional coactivator. ZIMP7 is expressed most abundantly in testis. The C-terminal proline-rich domain possesses a significant intrinsic transcriptional activity and this activity is inhibited by the N-terminus in the full-length ZIMP7. ZIMP7 and the related protein ZIMP10 interact with PIAS3 and enhances Androgen Receptor (AR)- mediated transcription. The interaction between ZIMP7 and SWI/SNF complex suggests a possible role for ZIMP7 in chromatin modification.

Specifications

Accession Number Q8NF64
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83637
Name Human ZMIZ2 (aa 270-339) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D11Bwg0280e; HRIHFB2007; hZIMP7; KIAA1886; NET27; PIAS-like protein Zimp7; TRAFIP20; Zimp7; zinc finger MIZ domain-containing protein 2; zinc finger MIZ-type containing 2; zinc finger, MIZ-type containing 2; Zmiz2
Common Name ZMIZ2
Gene Symbol ZMIZ2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SEVYPGQQYLQGGQYAPSTAQFAPSPGQPPAPSPSYPGHRLPLQQGMTQSLSVPGPTGLHYKPTEQFNGQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less