missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ZMIZ1 (aa 410-495) Control Fragment Recombinant Protein

Catalog No. rp109251
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109251 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109251 Supplier Invitrogen™ Supplier No. RP109251
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140136 (PA5-140136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Retinoic acid plays a critical role in development, cellular growth, and differentiation and induces the expression of a variety of genes. RAI17 expression is induced by retinoic acid and is predominantly expressed in heart, brain and ovaries. Within brain, highest expression is in amygdala. The deduced 1,067-amino acid protein contains an MSX-interacting zinc finger (MIZ) domain, a nuclear localization signal sequence, and 2 proline-rich regions. A strong intrinsic transactivation domain is identified in the C-terminal proline-rich region. RAI17 expression is detected in various cancer cell lines. RAI17 colocalizes with endogenous androgen receptor (AR) in the nuclei of prostate epithelial cells from human tissue samples. In human prostate cancer cells, RAI17 increases the transcriptional activity of AR. Studies using sumoylation-deficient AR mutants suggest that the increase of AR activity by RAI17 is dependent upon receptor sumoylation.

Specifications

Accession Number Q9ULJ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57178
Name Human ZMIZ1 (aa 410-495) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC065120; E330020C23; ENSMUSG00000072684; FLJ00092 protein; Gm10397; hZIMP10; I920194n01; KIAA1224; MIZ; PIAS-like protein Zimp10; Rai17; retinoic acid induced 17; retinoic acid-induced protein 17; RP11-519K18.1; TRAFIP10; Zimp10; Zinc finger MIZ domain-containing protein 1; zinc finger MIZ-type containing 1; zinc finger, MIZ-type containing 1; zinc finger-containing, Miz1, PIAS-like protein on chromosome 10; ZMIZ1
Common Name ZMIZ1
Gene Symbol ZMIZ1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPNYGNQQYGPNSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNYSQGNV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less