missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108659

Invitrogen™ Human ZC3H6 (aa 116-206) Control Fragment Recombinant Protein

Catalog No. RP108659
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108659 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108659 Supplier Invitrogen™ Supplier No. RP108659
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84990 (PA5-84990. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZC3H6 is a protein coding gene. Gene ontology (GO) annotation include nucleus.

Specifications

Accession Number P61129
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 376940
Name Human ZC3H6 (aa 116-206) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias KIAA2035; ZC3H6; ZC3HDC6; Zinc finger CCCH domain-containing protein 6; zinc finger CCCH type domain containing 6; zinc finger CCCH-type containing 6; zinc finger CCCH-type domain containing 6
Common Name ZC3H6
Gene Symbol ZC3H6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISGSYITSKKGQHNKKFKSKEYDEYSTYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKETSNIALGSSFSKESGKKQRMKGVQQGI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less