missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108502

Invitrogen™ Human XKR6 (aa 601-641) Control Fragment Recombinant Protein

Catalog No. RP108502
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108502 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108502 Supplier Invitrogen™ Supplier No. RP108502
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84668 (PA5-84668. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

XK is a 444 amino acid protein that spans the membrane 10 times and carries the ubiquitous antigen, Kx, which determines blood type. The XK (X-linked Kx blood group)-related gene family are homologs of XK. XKR6 (XK-related protein 6) is a 641 amino acid multi-pass membrane protein that likely is a component of the XK/Kell complex of the Kell blood group system. The gene encoding XKR6 maps to human chromosome 8, which is made up of nearly 146 million bases and encodes about 800 genes. There are two isoforms of XKR6 that are produced as a result of alternative splicing events.

Specifications

Accession Number Q5GH73
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 286046
Name Human XKR6 (aa 601-641) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC024502; C8orf21; C8orf5; C8orf7; LOW QUALITY PROTEIN: XK-related protein 6; RGD1310719; Transmembrane protein C8orf5; x Kell blood group precursor related family member 6 homolog; x Kell blood group precursor-related family, member 6; XK related 6; XK, Kell blood group complex subunit-related family, member 6; XKR6; XK-related protein 6; X-linked Kx blood group related 6; Xrg6
Common Name XKR6
Gene Symbol XKR6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less