missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP89040

Invitrogen™ Human WDR23 (aa 373-505) Control Fragment Recombinant Protein

Catalog No. RP89040
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89040 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89040 Supplier Invitrogen™ Supplier No. RP89040
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56658 (PA5-56658. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WDR23 contains 7 WD repeats. The function of WDR23 remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Specifications

Accession Number Q8TEB1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80344
Name Human WDR23 (aa 373-505) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0710008A13Rik; C76035; D14Ucla1; Dacf11; DCAF11; DDB1 and CUL4 associated factor 11; DDB1- and CUL4-associated factor 11; DKFZp779A1629; GL014; GLO14; PRO2389; WD repeat domain 23; WD repeat domain 23 isoform 1; WD repeat-containing protein 23; WDR23; WDR23 protein
Common Name WDR23
Gene Symbol Dcaf11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less