missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP98166

Invitrogen™ Human VPS33B (aa 273-362) Control Fragment Recombinant Protein

Catalog No. RP98166
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98166 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98166 Supplier Invitrogen™ Supplier No. RP98166
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59167 (PA5-59167. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and encodes the human ortholog of rat Vps33b which is homologous to the yeast class C Vps33 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.

Specifications

Accession Number Q9H267
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26276
Name Human VPS33B (aa 273-362) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ14848; hVPS33B; r-vps33b; vacuolar protein sorting 33 homolog B; vacuolar protein sorting 33 homolog B (yeast); vacuolar protein sorting 33 B; vacuolar protein sorting 33 B (yeast); vacuolar protein sorting 33-like protein B; vacuolar protein sorting homolog r-vps33b; vacuolar protein sorting-associated protein 33 B; vacuolar sorting protein 33 b; vps33b; VPS33B late endosome and lysosome associated; VPS33B, late endosome and lysosome associated; zgc:110803
Common Name VPS33B
Gene Symbol VPS33B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSLKVLLNAEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less