missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108882

Invitrogen™ Human UNC80 (aa 37-120) Control Fragment Recombinant Protein

Catalog No. RP108882
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108882 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108882 Supplier Invitrogen™ Supplier No. RP108882
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q8N2C7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 285175
Name Human UNC80 (aa 37-120) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C030018G13Rik; C230061B10Rik; C2orf21; Kiaa1843; LOC689991; mUNC-80; NALCN channel associated protein; protein unc-80 homolog; similar to CG18437-PA; UNC80; UNC-80; unc-80 homolog; unc-80 homolog (C. elegans); unc-80 homolog, NALCN activator; WUGSC:H_NH0436C12.1
Common Name UNC80
Gene Symbol UNC80
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less