missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UNC119B (aa 101-138) Control Fragment Recombinant Protein

Catalog No. RP109649
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109649 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109649 Supplier Invitrogen™ Supplier No. RP109649
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140033 (PA5-140033. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mouse Unc119b is related closely to Unc119, a homolog of C. elegans unc119 protein which was first discovered in C. elegans on the basis of a spontaneous mutation affecting locomotion, feeding behavior and chemosensation. Mouse Unc119b shares 90% sequence identity with human UNC119b protein. UNC119b is a myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Myristoyl-binding activity of UNC119b is required to localize NPHP3 to the primary cilium.

Specifications

Accession Number A6NIH7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84747
Name Human UNC119B (aa 101-138) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA407659; AI414892; POC7 centriolar protein homolog B; POC7B; Protein unc-119 homolog B; protein unc-119 homolog B; LOW QUALITY PROTEIN: protein unc-119 homolog B; unc119 homolog B; unc-119 homolog B; unc-119 homolog B (C. elegans); unc-119 lipid binding chaperone B; UNC119B
Common Name UNC119B
Gene Symbol UNC119B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less