missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108117

Invitrogen™ Human UBXN8 (aa 63-133) Control Fragment Recombinant Protein

Catalog No. RP108117
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108117 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108117 Supplier Invitrogen™ Supplier No. RP108117
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67460 (PA5-67460. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins, possibly by tethering VCP to the endoplasmic reticulum membrane. May play a role in reproduction.

Specifications

Accession Number O00124
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7993
Name Human UBXN8 (aa 63-133) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D8S2298E; REP8; Rep-8 protein; Reproduction 8 protein; Reproduction/chromosome 8; UBX domain protein 8; UBX domain-containing protein 6; UBX domain-containing protein 8; UBXD6; UBXN8
Common Name UBXN8
Gene Symbol UBXN8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less