missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP107672

Invitrogen™ Human TUT1 (aa 802-871) Control Fragment Recombinant Protein

Catalog No. RP107672
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107672 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107672 Supplier Invitrogen™ Supplier No. RP107672
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation. TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]).[supplied by OMIM].

Specifications

Accession Number Q9H6E5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64852
Name Human TUT1 (aa 802-871) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700038E08Rik; FLJ21850; FLJ22267; FLJ22347; MGC131987; MGC149809; nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpha regulated-poly(A) polymerase; nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase; PAP-associated domain-containing 2; PAPD2; poly(A) polymerase associated domain containing 2; RBM21; RNA binding motif protein 21; RNA uridylyltransferase; RNA-binding motif protein 21; RNA-binding protein 21; speckle targeted PIP5K1A-regulated poly(A) polymerase; STARPAP; Star-PAP; terminal uridylyl transferase 1 U6 snRNA-specific; terminal uridylyl transferase 1, U6 snRNA-specific; Tut1; TUTase; TUTase 6; TUTase6; U6 snRNA-specific terminal uridylyltransferase 1; U6 snRNA-specific terminal uridylyltransferase 1; speckle targeted PIP5K1A-regulated poly(A) polymerase; U6 TUTase; U6-TUTase; up-regulated in lung cancer 6; URLC6
Common Name TUT1
Gene Symbol TUT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less