missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRUB2 (aa 85-167) Control Fragment Recombinant Protein

Catalog No. RP93038
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93038 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93038 Supplier Invitrogen™ Supplier No. RP93038
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54350 (PA5-54350. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]).

Specifications

Accession Number O95900
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26995
Name Human TRUB2 (aa 85-167) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CLONE24922; G430055L02Rik; Mitochondrial mRNA pseudouridine synthase TRUB2; probable tRNA pseudouridine synthase 2; RP11-339B21.1; TruB pseudouridine (psi) synthase family member 2; TruB pseudouridine (psi) synthase homolog 2; TruB pseudouridine (psi) synthase homolog 2 (E. coli); TruB pseudouridine synthase family member 2; Trub2
Common Name TRUB2
Gene Symbol TRUB2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less