missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108813

Invitrogen™ Human TRPM7 (aa 30-105) Control Fragment Recombinant Protein

Catalog No. RP108813
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108813 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108813 Supplier Invitrogen™ Supplier No. RP108813
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants.

Specifications

Accession Number Q96QT4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54822
Name Human TRPM7 (aa 30-105) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310022G15Rik; 4833414K03Rik; 5033407O22Rik; ALSPDC; CHAK; CHAK1; Channel kinase 1; Channel-kinase 1; FLJ20117; long transient receptor potential channel 7; long transient receptor potential channel 7 {ECO:0000250; Ltpr7; LTRPC ion channel family member 7; LTRPC7; LTrpC-7; LTrpC7 {ECO:0000250; PubMed:11161216}; RGD:620053}; tr; transient receptor potential cation channel subfamily M member 7; transient receptor potential cation channel subfamily M member 7 {ECO:0000312; transient receptor potential cation channel, subfamily M, member 7; transient receptor potential M7; transient receptor potential-phospholipase C-interacting kinase; transient receptor potential-phospholipase C-interacting kinase {ECO:0000303; transient receptor potential-related protein, ChaK; TRMP7; TRP PLIK; Trpm7; trpm7 {ECO:0000312; TRPPLIK; Trp-plik; TRP-PLIK {ECO:0000303; UniProtKB:Q96QT4}
Common Name TRPM7
Gene Symbol Trpm7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGDHFNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less