missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109408

Invitrogen™ Human TRPM3 (aa 1274-1337) Control Fragment Recombinant Protein

Catalog No. RP109408
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109408 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109408 Supplier Invitrogen™ Supplier No. RP109408
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139988 (PA5-139988. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

Accession Number Q9HCF6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80036
Name Human TRPM3 (aa 1274-1337) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330504P12Rik; 9330180E14; AU018608; B930001P07Rik; GON-2; KI; KIAA1616; Long transient receptor potential channel 3; LTRPC3; LTrpC-3; melastatin 2; melastatin-2; MLSN2; si:dkey-201c13.4; transient receptor potential cation channel subfamily M member 3; transient receptor potential cation channel, subfamily M, member 3; transient receptor potential melastatin 3; transient receptor potential melastatin 3 beta 1; transient receptor potential melastatin 3 beta 10; transient receptor potential melastatin 3 beta 11; transient receptor potential melastatin 3 beta 12; transient receptor potential melastatin 3 beta 13; transient receptor potential melastatin 3 beta 14; transient receptor potential melastatin 3 beta 15; transient receptor potential melastatin 3 beta 16; transient receptor potential melastatin 3 beta 17; transient receptor potential melastatin 3 beta 2; transient receptor potential melastatin 3 beta 3; transient receptor potential melastatin 3 beta 4; transient receptor potential melastatin 3 beta 5; transient receptor potential melastatin 3 beta 6; transient receptor potential melastatin 3 beta 7; transient receptor potential melastatin 3 beta 8; transient receptor potential melastatin 3 beta 9; trpm3
Common Name TRPM3
Gene Symbol TRPM3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less