missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP91759

Invitrogen™ Human TRMT61B (aa 224-338) Control Fragment Recombinant Protein

Catalog No. RP91759
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91759 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91759 Supplier Invitrogen™ Supplier No. RP91759
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (22%), Rat (22%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55402 (PA5-55402. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Methyltransferase that catalyzes the formation of N(1)-methyladenine at position 58 (m1A58) in various tRNAs in mitochondrion, including tRNA(Leu) (decephering codons UUA or UUG), tRNA(Lys) and tRNA(Ser) (decephering codons UCA, UCU, UCG or UCC).

Specifications

Accession Number Q9BVS5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55006
Name Human TRMT61B (aa 224-338) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110039F03Rik; 623451; Gm6431; mRNA methyladenosine-N(1)-methyltransferase; potential tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61B; potential tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61B; TRMT61B; tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial; tRNA methyltransferase 61 homolog B; tRNA methyltransferase 61 B
Common Name TRMT61B
Gene Symbol TRMT61B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KRGTAITFPKDINMILSMMDINPGDTVLEAGSGSGGMSLFLSKAVGSQGRVISFEVRKDHHDLAKKNYKHWRDSWKLSHVEEWPDNVDFIHKDISGATEDIKSLTFDAVALDMLN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less