missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP99846

Invitrogen™ Human TOR1AIP2 (aa 3-63) Control Fragment Recombinant Protein

Catalog No. RP99846
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99846 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99846 Supplier Invitrogen™ Supplier No. RP99846
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63560. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

One of the two protein isoforms encoded by this gene is a type II integral membrane protein found in the endoplasmic reticulum (ER). The encoded protein is a cofactor for the ATPase TorsinA, regulating the amount of TorsinA present in the ER compared to that found in the nuclear envelope. Defects in this protein are a cause of early onset primary dystonia, a neuromuscular disease. The other isoform encoded by this gene is an interferon alpha responsive protein whose cellular role has yet to be determined.

Specifications

Accession Number Q8NFQ8
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 163590
Name Human TOR1AIP2 (aa 3-63) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1110020D10Rik; 15 kDa interferon-responsive protein; 15kDa; A130072J07; AA103493; AW060462; AW610675; C77739; Ifrg15; interferon alpha responsive gene, 15 kDa; interferon alpha responsive protein (15 kDa); interferon alpha responsive protein; torsin-1A-interacting protein 2; interferon responsive gene 15; Lull1; lumenal domain like LAP1; lumenal domain-like LAP1; NET9; RP11-12M5.5; TOR1AIP2; torsin 1A interacting protein 2; torsin A interacting protein 2; torsin-1A-interacting protein 2; Torsin-1A-interacting protein 2, isoform IFRG15
Common Name TOR1AIP2
Gene Symbol TOR1AIP2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less