missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90965

Invitrogen™ Human TMEM261 (aa 1-50) Control Fragment Recombinant Protein

Catalog No. RP90965
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90965 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90965 Supplier Invitrogen™ Supplier No. RP90965
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53197 (PA5-53197. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Involved in the assembly of the distal region of complex I. [UniProt]

Specifications

Accession Number Q96GE9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 90871
Name Human TMEM261 (aa 1-50) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700027K24Rik; 3110001D03Rik; C9orf123; distal membrane arm assembly complex 1; Distal membrane-arm assembly complex protein 1; Dmac1; Tmem261; Transmembrane protein 261; transmembrane protein C9orf123; transmembrane protein C9orf123 homolog
Common Name TMEM261
Gene Symbol DMAC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less