missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108644

Invitrogen™ Human TMEM158 (aa 174-224) Control Fragment Recombinant Protein

Catalog No. RP108644
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108644 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108644 Supplier Invitrogen™ Supplier No. RP108644
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84968 (PA5-84968. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Specifications

Accession Number Q8WZ71
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 25907
Name Human TMEM158 (aa 174-224) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310037P21Rik; 40 kDa BINP-binding protein; BBP; BINP binding protein p40BBP; BINP receptor; brain injury-derived neurotrophic peptide (BINP) binding protein; brain specific binding protein; brain-specific binding protein; HBBP; Mbbp; p40BBP; Ras induced senescence 1; Ras-induced senescence 1; ras-induced senescence protein 1; Ris1; Tmem158; Transmembrane protein 158; transmembrane protein 158 (gene/pseudogene)
Common Name TMEM158
Gene Symbol TMEM158
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less