missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109805

Invitrogen™ Human TIMP3 (aa 139-211) Control Fragment Recombinant Protein

Catalog No. RP109805
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109805 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109805 Supplier Invitrogen™ Supplier No. RP109805
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144953 (PA5-144953. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tissue inhibitor of metalloproteinase 3 (TIMP3) is a member of the tissue inhibitor of metalloproteinases gene family. It functions to inhibit the activity of matrix metalloproteinases (MMP) which degrade components of the extracellular matrix. TIMP3 is expressed upon mitogenic stimulation. It binds irreversibly to zinc-dependent MMPs and inactivates them by binding to their catalytic zinc cofactor. Other functions of TIMP3 include nervous system development, tissue regeneration, and visual perception. In humans, the gene encoding TIMP3 is located on chromosome 22.

Specifications

Accession Number P35625
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7078
Name Human TIMP3 (aa 139-211) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG-5 protein; protein MIG-5; SFD; Sun; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP metallopeptidase inhibitor 3 (Sorsby fundus dystrophy, pseudoinflammatory); TIMP metallopeptidase inhibitor 3 L homeolog; timp3; TIMP-3; TIMP-3 protein; timp3.L; timp3-A; tissue inhibitor metalloproteinase-3; tissue inhibitor of metalloproteinase 3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory); tissue inhibitor of metalloproteinase-3; tissue inhibitor of metalloproteinase-3 precursor; tissue inhibitor of metalloproteinases 3; tissue inhibitor of metalloproteinases-3; XELAEV_18002484mg
Common Name TIMP3
Gene Symbol TIMP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less