missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109814

Invitrogen™ Human TCTEX1D4 (aa 148-221) Control Fragment Recombinant Protein

Catalog No. RP109814
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109814 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109814 Supplier Invitrogen™ Supplier No. RP109814
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144835 (PA5-144835. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dyneins are multi-subunit, high molecular weight ATPases that interact with microtubules to generate force by converting the chemical energy of ATP into the mechanical energy of movement. Cytoplasmic or axonemal Dynein is an approximately 12 subunit complex of two heavy chains, two intermediate chains to anchor Dynein to its cargo, four smaller intermediate chains and several light chains. It performs functions necessary for cell survival such as organelle transport and centrosome assembly. TCTEX1 is a cytoplasmic dynein light chain found in a complex with Na+ CP type X (SCN10A). TCTEX1D4, also called TCTEX2 beta, interacts with different members of the TGF-beta receptor family, and when overexpressed, inhibits TGF-beta signaling.

Specifications

Accession Number Q5JR98
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 343521
Name Human TCTEX1D4 (aa 148-221) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833401D15Rik; LOC102551208; N22.1; novel Tctex-1 family domain-containing protein; protein N22.1; Tcte x 1 domain containing 4; tcte x 1 domain-containing protein 4; tcte x 1 domain-containing protein 4-like; Tcte x 1d4; Tcte x 2 beta; Tctex-2-beta
Common Name TCTEX1D4
Gene Symbol TCTEX1D4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less